SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000006872 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000006872
Domain Number 1 Region: 124-286
Classification Level Classification E-value
Superfamily vWA-like 9.89e-50
Family Integrin A (or I) domain 0.0000000319
Further Details:      
 
Domain Number 2 Region: 563-604
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000131
Family Integrin beta EGF-like domains 0.00034
Further Details:      
 
Domain Number 3 Region: 349-393
Classification Level Classification E-value
Superfamily Integrin domains 0.00000115
Family Integrin domains 0.00021
Further Details:      
 
Domain Number 4 Region: 2-30
Classification Level Classification E-value
Superfamily Plexin repeat 0.000034
Family Plexin repeat 0.00054
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000006872
Domain Number - Region: 537-560
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00446
Family Integrin beta EGF-like domains 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000006872   Gene: ENSVPAG00000007390   Transcript: ENSVPAT00000007390
Sequence length 758
Comment pep:novel genescaffold:vicPac1:GeneScaffold_2810:603645:654187:1 gene:ENSVPAG00000007390 transcript:ENSVPAT00000007390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNICATRGVSSCQQCLAVSPMCAWCSDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXKDDLWSIQNLGTKLASQMRKLTSNLRIGFGAFVDKPVSPYMFISPPEALKNPCYDMK
TTCLPMFGYKHVLTLTDQWTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNE
ASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIRFKVELEVRD
LPEKLSLSFNATCLNNEVIPGLKSCVGLKIGDTXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHGQ
CNCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGNCVCIQPGSYGDTCEKC
PTCPDACTFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXCMACLGTMLIILPVFTLNGLATLFIWKLLITIHDR
KEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT
Download sequence
Identical sequences ENSVPAP00000006872 ENSVPAP00000006872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]