SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000006944 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000006944
Domain Number 1 Region: 1-167
Classification Level Classification E-value
Superfamily vWA-like 4.79e-32
Family Integrin A (or I) domain 0.0000000548
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000006944
Domain Number - Region: 170-249
Classification Level Classification E-value
Superfamily E set domains 0.0315
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000006944   Gene: ENSVPAG00000007464   Transcript: ENSVPAT00000007463
Sequence length 440
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2359:382863:462419:-1 gene:ENSVPAG00000007464 transcript:ENSVPAT00000007463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGSVANNWIEIYNFVQQLTERFVSPQMRLSFIVFSSQATIILPLTGDRGKISEGLDNLKR
VSPVGETYIHEGLKLANEQIEKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGA
RVYCVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQSCTEVLELRPSSVCV
GEEFQIVLTGRGFNLGSRNGSVLCTYTVNETYTKSVMPVTVERNSMLCPAPALHEVGETL
DVSVSFNGGKSVISSSXXXXXXXXSNGIAALIAILVLLLLLAIGLMWWFWPLCCKVXXXD
PPPPPSAPQEEEKEPLPTKKWPTVDASYYGGRGVGGIKRMEVRWGDKGSTEEGARLEKAK
NAVVTIPEEPEEPVRPRPPRPKPTHQPPQTKWYTPIKGRLDALWALLRRQYDRVSLMRPQ
EGDEVCMWGRAGKILTLASR
Download sequence
Identical sequences ENSVPAP00000006944 ENSVPAP00000006944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]