SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000006966 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000006966
Domain Number 1 Region: 484-780
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.24e-73
Family Protein kinases, catalytic subunit 0.00000000159
Further Details:      
 
Domain Number 2 Region: 773-844
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.09e-19
Family SAM (sterile alpha motif) domain 0.00019
Further Details:      
 
Domain Number 3 Region: 191-289
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000184
Family Fibronectin type III 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000006966
Domain Number - Region: 126-189,224-250
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00392
Family Growth factor receptor domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000006966   Gene: ENSVPAG00000007487   Transcript: ENSVPAT00000007487
Sequence length 849
Comment pep:novel genescaffold:vicPac1:GeneScaffold_2115:366:321724:1 gene:ENSVPAG00000007487 transcript:ENSVPAT00000007487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
THTCTPTPTRARTAPRAHTPAHAHAALRGVRSQPERERIRRSHRRGAQRRPGTRRPPRAA
ASARARPGSRRPAMALDCLLLLLLATAVAAMEXXXXXXXXXXXXXXXXXXXXXXDEENIF
SIGRWSCHPGNQENMACKASPAGMFKASQEAEGCSHCPSNSRSPSEASPICTCRTGYYRA
DFDPPEVACTSVPSGPRNVISIVNETSIILEWHPPRETGGRDDVTYNIICKKCRADRRSC
SRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAVNGVSSKSPFPPQHVSVNITTN
QAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXKRAYSKEAVYSDKLQHYSTGRGSPGMKIYIDPFTYEDPNEAVREF
AKEIDVSFVKIEEVIGAGELGEVYKECLELLCKREIYVAIKTLKTGYSEKQCPDFLKASV
MGQFHHPNVIRLEGMLTDSRPVMAIPEFMESTLDSILRQNDGQFTVIQLVGMLRGIAAGM
KFLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLIPVRWTAPEA
IAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQ
LMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITAVPSQPLLDRSIPDFTAFTT
VDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTSEDLLRIGVTLAGHQKKILNSILSMRVQ
MSQSPTAMA
Download sequence
Identical sequences ENSVPAP00000006966 ENSVPAP00000006966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]