SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007017 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007017
Domain Number 1 Region: 35-90,288-366
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.83e-18
Family FAD/NAD-linked reductases, N-terminal and central domains 0.014
Further Details:      
 
Domain Number 2 Region: 97-218,292-365
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000122
Family FAD/NAD-linked reductases, N-terminal and central domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007017   Gene: ENSVPAG00000007545   Transcript: ENSVPAT00000007544
Sequence length 473
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1105:42060:59978:1 gene:ENSVPAG00000007545 transcript:ENSVPAT00000007544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAIHFPSEDILLITASPVIKAVTNFKQVSKVLEEFDVEEQPSTLLENRFPNIKVIESGVK
QLKSEEHCVLTEDGNQHLYKKLCLCAGAKPKLICEGNPYVLGIRDTDSAQEFQKQLTKAK
RIMIIGNGGIALELVYEIEGCEVIWVIKDKAIGNTFFDAGAAEFLTSKLIAEKSEAKIAQ
KRTRYTTEGRKKEAQTKGSAGNIGSALGPDWHELNLKGTKEFSHKIHIETMCEVKKIYLQ
EEFRISKKKSLTFPRDHHNQSVTADKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXFDVGEDGGLKVNDHMHTSLPDIYAAGDICTASWEPSPVWQQMRLWTQARQMGWYAA
KCMAAASVGESVDMDFSFELFAHVTKFFNFKVVLLGKYNAQGLGSDHELILRCTKGQEYV
KAVLQNGRMMGAVLIGETDLEETFENLILNQMNLSAYGEDLLDPNIDIEDYFD
Download sequence
Identical sequences ENSVPAP00000007017 ENSVPAP00000007017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]