SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007024 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007024
Domain Number 1 Region: 41-236
Classification Level Classification E-value
Superfamily E set domains 4.11e-65
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000312
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000235
Family Voltage-gated potassium channels 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007024   Gene: ENSVPAG00000007551   Transcript: ENSVPAT00000007551
Sequence length 298
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1105:288697:289728:-1 gene:ENSVPAG00000007551 transcript:ENSVPAT00000007551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFTSAFLFFIEVQETIGFGGRLMTEECLLIITVEILQNAVGQIINSVMFGCIFMKTAQAH
RRAETLIIIRHAVISVRNGNYCFMFRVGDLRKSMIISASVRIQVVKKTTTPEGEVVPIHQ
LDIPVDNPIESNNICLVAPIICHVIDKRSPLYDISATDLANQDLEVIVILEGVVETTGIT
TQARTSYIAEEIQWGHRFVSIVTEEEGVYSVDYSKFGNTVKVAAPRCSARELDEKPSILI
QTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPKVQFMTPEGTQNTSES
Download sequence
Identical sequences ENSVPAP00000007024 ENSVPAP00000007024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]