SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007169 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007169
Domain Number 1 Region: 145-297
Classification Level Classification E-value
Superfamily E set domains 1.75e-23
Family Arrestin/Vps26-like 0.04
Further Details:      
 
Domain Number 2 Region: 2-74
Classification Level Classification E-value
Superfamily E set domains 0.000077
Family Arrestin/Vps26-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007169   Gene: ENSVPAG00000007708   Transcript: ENSVPAT00000007708
Sequence length 319
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3539:597:7129:-1 gene:ENSVPAG00000007708 transcript:ENSVPAT00000007708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPKDAVYLAGSSIKGQVVLTLNSTLVHPIVKVELVGRGYVEWNEEIGASRDYSRDVICN
NKADYVHKTKTFPVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXNPLLVEAEKKVSYNCCSQGTICLQIQMEKNTFRPGE
RVIFTTEINNQTSKCIKTVIFALYAHVQYEGFTPKAERRSRMDSSELLRQEANTQITPFN
TTKIVSAFHLPPVLSVSGGLQDSEIMNTHYELVSTVHLPWSMTSVKAKVPIVITSGPVDS
DSRRLMEGAVLPMSSDCRN
Download sequence
Identical sequences ENSVPAP00000007169 ENSVPAP00000007169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]