SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007179 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007179
Domain Number 1 Region: 38-128
Classification Level Classification E-value
Superfamily Lysozyme-like 0.000000000018
Family G-type lysozyme 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007179   Gene: ENSVPAG00000007721   Transcript: ENSVPAT00000007720
Sequence length 212
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1520:182283:190786:-1 gene:ENSVPAG00000007721 transcript:ENSVPAT00000007720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSFALFGGLFALIGTSRGSHTFTHSMNSRLHPPLYHGCYGDITTMETSGASCDIGKLIN
CGIPGSEMFADMDLRALKPYRTLIKEVGLRHCVDPALIAAIISRVSHGGTVLLDGWDHTG
NKFGLMQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLSAFK
SGAEAVATLKDIDTDFVNDTMARAKFFKRHGF
Download sequence
Identical sequences ENSVPAP00000007179 ENSVPAP00000007179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]