SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007200 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007200
Domain Number 1 Region: 497-682,890-1029
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 4.45e-59
Family Regulator of chromosome condensation RCC1 0.012
Further Details:      
 
Domain Number 2 Region: 4377-4452
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000251
Family RING finger domain, C3HC4 0.024
Further Details:      
 
Domain Number 3 Region: 2315-2390
Classification Level Classification E-value
Superfamily E set domains 0.000003
Family Filamin repeat (rod domain) 0.013
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000007200
Domain Number - Region: 178-258,3955-4023
Classification Level Classification E-value
Superfamily ARM repeat 0.000301
Family Armadillo repeat 0.045
Further Details:      
 
Domain Number - Region: 3755-3824
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000723
Family beta-mannanase CBM 0.066
Further Details:      
 
Domain Number - Region: 3634-3704
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0774
Family APC10-like 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007200   Gene: ENSVPAG00000007741   Transcript: ENSVPAT00000007741
Sequence length 4591
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3006:410847:664890:-1 gene:ENSVPAG00000007741 transcript:ENSVPAT00000007741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVPEGSLAAAGLGLGLPAADSRGHYQLLLSGRALADRYRRIYTAALSDRDQGGSSAGHP
ASRNKKILNKKKLKRKQKSKSKVKTRSKSENLENTVIIPDIKLHSNPSAFNIYCNVRHCI
LEWQKKETSLAAASKNSVQSGESDSDEEEESKEPPIKLPKIIEVGLCEVFELIKETRFSH
PSLCLRSLQALLNVLQGQQPEGLQSEPPEVLESLFQLLLEITVRSTGMNDSTGQSLTALS
CACLFSLVAAWGETGRTLQAISAILTNNGSHACQTIQVPMILNSLQRSVQAVLVGKIQIQ
DWFSNGIKKAALMHKWPLKEISVDEDDQCLLQNDGFFLYLLCKDGLYKIGSGYSGTVRGH
IYNSTSRIRNRKEKKSWLGYAQGYLLYRDVNNHSMTAIRISPETLEQDGTVMLPDCHTEG
QNILFTDGEYINQIAASRDDGFVVRIFATSTEPVLQQELQLKLARKCLHACGISLFDLEK
DLHIISTGFDEESAILGAGREFALMKTANGKIYYTGKYQSLGIKQGGPSAGKWVELPITK
SPKIVHFSVGHDGSHALLVAEDGSIFFTGSASKGEDGESTKSRRQSKPYKPKKIIKMEGK
IVVYTACNNGSSSVISKDGELYMFGKDAIYSDSSSLVTDLKGHFVTQVAMGKAHTCVLMK
NGEVWTFGVNNKGQCGRDTGAMNQGGKGFGVENMATAMDEDLEEELDEKDEKSMMCPPGM
HKWKLEQCMVCTVCGDCTGYGASCVSSGRPDRVPGGICGCGSGESGCAVCGCCKACAREL
DGQEARQRGILDAVKEMIPLDLLLAVPVPGVNIEEHLQLRQEEKRQRVIRRHRLDEGRGP
LVFAGPIFMNHREQALARLRSHPAQLKHKRDKHKDGSGERGEKDASKITTYPPGSVRFDC
ELRAVQVSCGFHHSVVLMENGDVYTFGYGQHGQLGHGDVNSRGCPTLVQALPGPSTQVTA
GSNHTAVLLMDGQVFTFGSFSKGQLGRPILDVPYWNAKPAPMPNIGSKYGRKATWIGASG
DQTFLRIDEALINSHVLATSEFASKHIIGLVPASISEPPPFKCLLINKVDGSCKTFNDSE
QEDLQGFGVCLDPVYDVIWRFRPNTRELWCYNAVVADARFPSAADMQSRCSILSPELALP
TGSRALTTRSHAALHILGCLDTLAAMQDLKMGVASTEEETQAVMKVYSKEDYSVVNRFES
HGGGWGYSAHSVEAIRFSADTDILLGGLGLFGGRGEYTAKIKLFELGPDGGDHEIDGDLN
AETDVLAYDCGAREKYAMMFDEPVLLQAGWWYVAWARVSGPSSDCGSHGQASITTDDGVV
FQFKSSKKSNNGTDVNAGQIPQLLYRLPTSDGSASKGKQQTSEPVHILKRSFARTVSVCE
SLLSIHWSWTTVGVEELRGLKGFQFTATLLDLERLRFVGTCCLRLLRVYTCEIYPVSATG
KAVVEETSKLAECIGKTRTLLRKILSEGVDHCMVKLDNDPQGYLSQPLSLLEAVLQECHN
TFTACFHSFYPTPALQWACLCDLLNCLDQDIQEANFKTSSSRLLAAVMSALCHTSVKLTS
IFPIAYDGEVLLRSIVKQVSTENDSTLVHRFPLLVAHMEKLSQNEENISGMTSFREVLEK
MLVIVVLPVRNSLRREHELFSSHLVSNTCGLLASIVSELTASALGSIDGLNSLHSVKASA
NRFTKTSQGRSWNTGNGSPDAICFSVDKPGIVVVGFSVYGGGGIHEYELEVLVDDSEHAG
DSTHSHRWTSLELVKGTYTTDDSPSDIAEIRLDKVVPLKENVKYAVRLRNYGSRTANGDG
GMTTVQCPDGVTFTFSTCSLSSNGTNQTRGQIPQILYYRSEFDGDLQSQLLSKANEEDKN
CSRALSVVSTVVRAAKDLLHRALAVDADDIPELLSSSSLFSMLLPLIIAYIGPVAAAIPK
VAVEVFGLVQQLLPSVAILNQKYAPPAFNPNQSTDSTTGNQPEQGLSACTTSNHYAVIES
EHPYKPACVMHYKVTFPECVRWMTIEFDPQCGTAQSEDVLRLLIPVRTVQNSGYGPKLTS
VHENLNSWIELKKFSGSSGWPTMVLVLPGNEALFSLETASDYVKDEKASFYGFKCFAIGY
EFSPGPDEGVIQLEKELANLGGVCAAALMKKDLALPIGNELEEDLEILEEAALQVCKTHS
GILGKGLALSHSPTILEALEGNLPLQIQSNEQSFLDDFIACVPGSSGGRLAXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVEVKAVPVSQKKTSLQQEQV
KKAQRIPGSPAVTAPSSNTDMTFGGLASPKLDVSYEPMIVKEARYIAITMMKVYENYSFE
ELRFASPTPKRPSENMLIRVNNDGTYCANWTPGAIGLYTIHVTIDGIEIDAGLEVKVKDP
PKGMIPPGTQLVKPKTEPHPNKVRKFVAKDSAGLRIRSHPSLQSEQIGIVKVNGTITFID
EIHNDDGVWLRLNDETIKKYVPNMNGYTEAWCLSFNQHLGKSLLVPVDEPKTNTDDFFKD
INSCCPQEATMQEQDMPFLRGGPGMYKVVKTGPSGHNIRSCPNLRGIPIGMLVLGNKVKA
VGEVTNSEGTWVQLDKNSMVEFCESDEGEAWSLARDRGGNQYLRQEDEQVLLDQNSQTPP
PSPFSVQAFNKGASCSAQGFDYGLGNNKGDRGTISTPRPVCTSGKSELSSKHSRTLKPDG
RMSRTTADQKKPRGTEGLSASESLMLKSDAAKLRSDSHSRSLSPNHNTLQTLKSDGRMSS
SLRAESPGPGSRPSSPKPKTLPANRSSPSGASSPRSSSPHEKNLPQKSTAPVKTKLDPPR
ERSKSDSYTLDPDTLRKKKMPLTEPLRGRSTSPKPKPVPKDAKESSGSENRAPSPHVVQE
NLHSEVVEVCTSSTLKTNSLTDSTCDESSEFKSVDEGSNKVHFSIGKAPLKDEQEMRASP
KISRKCANRHTRPKKEKSSFLFKGDGAKPLEPAKQAMSPSVAECARAVFASFLWHEGIVH
DAMACSSFLKFNPELSKEHAPIRSSLNSQQPTEEKETKLKNRHSLEISSALNMFNISPHG
PDISKMGSINKNKVLSMLKEPPLHEKCEDGKTEATFEMSMHHPMKSKSPLPLTLQHLVAF
WEDISLATIKAASQNMIFPSPGSCAVLKKKECEKENKKAKKEKKKKDKTEVRPRGNLFGE
MAQLAVGGPEKDTICELCGESHPYPVTYHMRQAHPGCGRYAGGQGYNSIGHFCGGWAGNC
GDGGIGGSTWYLVCDRCREKYLREKQAAAREKVKQSRRKPLQVKTPRALPTMEAHQVIKA
NALFLLSLSSAAEPSILCYHPTKPFQSQLPSVKEGISEDLPVKMPCLYLQTLARHHHENF
VGYQDDNLFQDEMRYLRSTSVPAPYISVTPDASPNVFEEPESNMKSMPPSLETSPITDTD
LAKRTVFQRSYSVVASEYDKQHSILPARVKAIPRRRVNSGDTXXXXXXXXXXXXXXXXXX
XXXSSLSKGERNFQWPVLAFVIQHHDLEGEIAMKQLRKSACRVFAMEAFNWLLCNVIQTT
SLHDILWHFVASLTPAPVXXXXXXXXXXXXXXXXXXXEKDTRVCEHPLSDIVIAGEAAHP
LPHTFHRLLQTISDLMMSLPSGSSLQQMALRCWSLKFKQSDHQFLHQSNVFHHINNILSK
SDDGDSEESFSISIQSGFEAMSQELCIVMCLKDLTSIVDIKTSSRPAMXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESNKVTSMTFLTGKAVEDLCRIKQV
DLDSRHIGWVTSELPGGDNHIIKIELKGPENTLRVRQVKVLGWKDGESTKIAGQISASVA
QQRNCEAETLRVFRLITSQVFGKLISGDAEPTPEQEEKALLSSPEGEEKVYNATSDADLK
EHMVGIIFSRSKLTNLQKQVCAHIVQAIRMEATRVREEWEHAISSKENANSQPSDEDASS
DAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDLFSLLHTASPRVQRQVTSLLRRVLPEV
TPNRLASIIGVKSLPPADISDIIHSTEKGDWNKLGILDMFLGCIAKALTVQLKAKGTTIT
GTAGTSVGKGVTTVTLPMIFNSSYIRRGESHWWMKGSTPTQISEIIIKLIKDMAAGHLSE
AWSRVTKNAIAETIIALTKMEEEFRSPVRCIATTRLWLALASLCVLDQDHVDRLSSGRWM
GKDGQQKQMPMCDNHDDGETAAIILCNVCGNLCTDCDRFLHLHRRTKTHQRQVFKEEEEA
IKVDLHEGCGRTKLFWLMALADSKTMKAMVEFREHTGKPTTSSSEACRFCGSRSGTELSA
VGSVCSDADCQEYAKIACSKTHSCGHPCGGVKNEEHCLPCLHGCDKSATALKQDADDMCM
ICFTEALSAAPAIQLDCSHVFHLQCCRRVLENRWLGPRITFGFISCPICKNKINHIVLKD
LLDPIKELYEDVRRKALMRLEYEGLHKSEAITTPGVRFYNDPAGYAMNRYAYYVCYKCRK
AYFGGEARCDAEAGQGDDYDPRELICGACSDVSRAQMCPKHGTDFLEYKCRYCCSVAVFF
CFGTTHFCNACHDDFQRMTSIPKEELPHCPA
Download sequence
Identical sequences ENSVPAP00000007200 ENSVPAP00000007200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]