SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007223 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007223
Domain Number 1 Region: 54-365
Classification Level Classification E-value
Superfamily Sema domain 7.32e-64
Family Sema domain 0.0016
Further Details:      
 
Domain Number 2 Region: 1521-1722
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.63e-30
Family p120GAP domain-like 0.037
Further Details:      
 
Domain Number 3 Region: 814-859
Classification Level Classification E-value
Superfamily E set domains 0.00000000815
Family E-set domains of sugar-utilizing enzymes 0.064
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000007223
Domain Number - Region: 1042-1082
Classification Level Classification E-value
Superfamily E set domains 0.00123
Family E-set domains of sugar-utilizing enzymes 0.04
Further Details:      
 
Domain Number - Region: 1218-1288
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00628
Family p120GAP domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007223   Gene: ENSVPAG00000007766   Transcript: ENSVPAT00000007766
Sequence length 1753
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_317:24854:347183:-1 gene:ENSVPAG00000007766 transcript:ENSVPAT00000007766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRAQRLCLLVRAPLRMEQRRPWPRAAEGDGWPVVLLSAVCVLLAPRTAGMPQFSTFHSEN
RDWTFNHLTVHRGTGAVYVGAINRVYKLTGNLTIQVAHKTGPEEDNKSCYPPLIVQPCSE
VLTLTNNVNKLLIIDYSENRLLACGSLYQGVCKLLRLDDLFILVEPSHKKEHYLSSVNKT
GTMYGVIVRSEGEDGKLFIGTAVDGKQDYFPTLSSRKLPRDPESSAMLDYELHSDFVSSL
IKIPSDTLALVAHFDIFYIPVPIDDNFCGLDINQPLGGSTPVEGLTLYTTSRDRMTSVAS
YVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLKDGSPILRDMAFSIDQRYLYI
MSERQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCSRRDKCQRAREPNRFAASIS
QCMRLEVHPSSISVSEHSRLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCLSCVNSARCHWCKYR
NLCTHDPTTCSFQEGRINILEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXYQYDGMDISNLAVDFAVVWNGNFIIDNPQDLK
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLPGDYIIAEXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPSVLSLNPIRGPESGGTMVTITGHY
LGAGSSVAVYLGNQTCEFYGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXSGGAKLNYTVLIGETPCAVTVSETQLLCEPPNLTGQHKVMVHVGG
MVFSPGSVSVISDSLLTLPAIVSIAAGGSLLLIIVIIVLIAYKRKSRENDLTLKRLQMQM
DNLESRVALECKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XAQGNGQQHVEKLKLAQLINNKVLLTFIRTLELQRSFSMRDRGNVASLIMTGVQGRLEYA
TDVLKQLLSDLIDKNLENKNHPKLLLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILNCVNPDNENSPEIPVKVLN
CDTITQVKEKILDAVYKNVPYSQRPRAVDMDLEWRQGRIARVVLQDEDITTKIEGDWKRL
NTLMHYQVSDRSVVALVPKQTSSYNIPASASISRTSISRYDSSFRYTGSPDSLRSRAPMI
TPDLESGVKVWHLVKNHDHGDQKEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETLFS
TVHRGSALPLAIKYMFDFLDEQADRHSIHDTDVRHTWKSNCLPLRFWVNVIKNPQFVFDI
HKGSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPSYKSWVERYYADIAKL
PAISDQDMNAYLAEQSRLHAVEFNMLSALNEIYSYVSKYSEELIGALEQDEQARRQRLAY
KVEQLINAMSIES
Download sequence
Identical sequences ENSVPAP00000007223 ENSVPAP00000007223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]