SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007397 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007397
Domain Number 1 Region: 795-944
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.07e-35
Family Protein kinases, catalytic subunit 0.000000126
Further Details:      
 
Domain Number 2 Region: 612-709
Classification Level Classification E-value
Superfamily Fibronectin type III 9.26e-18
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 3 Region: 427-550
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000498
Family Fibronectin type III 0.0075
Further Details:      
 
Domain Number 4 Region: 352-431
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000348
Family I set domains 0.043
Further Details:      
 
Domain Number 5 Region: 521-610
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000328
Family Fibronectin type III 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000007397
Domain Number - Region: 202-320
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00424
Family Growth factor receptor domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007397   Gene: ENSVPAG00000007949   Transcript: ENSVPAT00000007951
Sequence length 1071
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3438:1169731:1232750:1 gene:ENSVPAG00000007949 transcript:ENSVPAT00000007951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDGAMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVTQDV
TREWAKKVVWKREKASKINGAYFCEGRVRGEAVRIRTMKMRQQASFLPATLTMTVDRGDN
VNISFRKVLIKEEDAVIYKNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXCEAQKWGPECNRVCTACMNNGICHEDTGECICPPGFMGRTCEKACELH
TFGRTCKERCSGPDGCKSYVFCLPDPYGCSCATGWTGLQCDEACQPGFYGPDCKLRCRCT
NGEMCDRFQGCLCSPGRQGVQCEKEGLPRMTPKIEDLPDHIEVNSGKFNPICKASGWPLP
ANEEMTLVKPDGTVLHPEDFNHTGHLSVATFTIHRILPPDSGVWVCSVNTVAGMVEKPFN
ISVKVLPKPLYAPNVIDTGHNFAVINISSEPYFGDGPIKSKKLLYKPVNHYEAWRHIQEY
ISVKYLEPRTEYELCVQEFTYGEYGEHPGPVRRFTTASIGLPPPRGLSLLPKSQTTLNLT
WQPIFPSSDDFYVEVERRSVKVNSDQQNIKVLFNLTAQLLXPPGEQYIVRARVNTKAQGE
WSEDLIAWTLSDILPPQPENIKISNITDSSAVISWTILDGYSISSIIIRYKIQGKNEDQH
IDVKIKNTTITQYQLKGLEPETVYQVDIFAENNIGSSNPTFSHELMTLSESQATADLGGG
KMLLIAILGSAGMTCLTVLLAFLIMLQLKRANIQRRMAQAFQNVREEPAVQFNSGTLALN
RKAKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKD
DHRDAGELEVLCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNLLDFLRKSRVLETDPA
FAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNCDDEVXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXTYVNTTLYEKFTYAGIDCSAEEAA
Download sequence
Identical sequences ENSVPAP00000007397 ENSVPAP00000007397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]