SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007402 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007402
Domain Number 1 Region: 1-74
Classification Level Classification E-value
Superfamily CAD & PB1 domains 4.12e-32
Family PB1 domain 0.00028
Further Details:      
 
Domain Number 2 Region: 112-227
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-21
Family PDZ domain 0.00000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007402   Gene: ENSVPAG00000007958   Transcript: ENSVPAT00000007958
Sequence length 343
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2990:374:1829:-1 gene:ENSVPAG00000007958 transcript:ENSVPAT00000007958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGAEFRRFSLDRQKPGKFEDFYKLVVHTHHISNTEVAIGYADVHGDLLPINNDDNFCKAV
SSASPLLRVFIQRREEAEHCSFGAGSLSRRRRPLALREDGPRRRAHLHIGLPHDFRPVSS
IIDVDILPETHRRVRLYRHGCQKPLGFYIRDGTSVRVAPQGLEKVPGIFISRMVPGGLAE
STGLLAVDDEVLEVNGIEVAGKTLDQVTDMMIANSHNLIVTVKPANQRNNVVRCGRVSGS
SGRSSDSTASRHSLPAAHVLQNLPTDEMESDEEPDVVLEGVLEPGWSPGTPGSLARVNGA
GLAPGLALGGSVHRLLSSLRSDPRHSLALPPGGVEEHGPAVTL
Download sequence
Identical sequences ENSVPAP00000007402 ENSVPAP00000007402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]