SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007707 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007707
Domain Number 1 Region: 25-145,210-282
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.02e-17
Family Reprolysin-like 0.072
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000007707
Domain Number - Region: 1070-1104
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000238
Family Complement control module/SCR domain 0.0093
Further Details:      
 
Domain Number - Region: 870-909
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000382
Family Complement control module/SCR domain 0.0088
Further Details:      
 
Domain Number - Region: 339-360,541-598
Classification Level Classification E-value
Superfamily Fibronectin type III 0.019
Family Fibronectin type III 0.0081
Further Details:      
 
Domain Number - Region: 1214-1243
Classification Level Classification E-value
Superfamily Notch domain 0.0288
Family Notch domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007707   Gene: ENSVPAG00000008279   Transcript: ENSVPAT00000008283
Sequence length 1287
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3104:292895:590402:1 gene:ENSVPAG00000008279 transcript:ENSVPAT00000008283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CNQFPRFRRPKAARYRVVYLRVDGGENPSVSRQQIDFQHRQLAEAFKHYNISWELEVLEV
SNSSLRHRLILANCDISKIGDENCDPECNHTLTGHDGGDCRHLRYPAFMKKQQNGVCDLD
CNYERFNFDGGECCDPDITDVTKTCFDPDSPHRAYLDVNELKNILRLDGSTHLNIFFANS
SEEXXXXXXXXXXXXXXXXXXXGIVLNPSFYGTPGHTHTMIHEIGHSLGLYHIFRGISEI
QSCSDPCMETEPSFETGDLCSDTNPAPKHKFCGDPGPGNDTCGFNSFFNTPFNNFMSYAD
DDCTDSFTPNQVARMHCYLDLVYQSWQPSRKPAPVALAPQIMGHTTDSVTLEWFPPIDGH
FFERELGSACDLCLEGRILVQFAFNASSPMPCGPSGHWSPREAEGHPDVEQPCKSSVRTW
SPNSAVNPHTVPPACPEPQGCYLELEFRYPLVPESLTIWVTFVSTDWDSSGAVNDIKLLT
VSGKNISLGPQNVFCDVPLTIRLRDVGEEVYGLQIYTLDEHLEIDAAMLTSVADSPLCLA
CKPLQYKVVRDPPLQADVASILHFSRRFTDMDLNLGSVYQYWVITISGNEESEPSPAAVY
IHGSGYCGDGIIQKSQGEECDDMNKVSGDGCSLFCRRESVFNCIXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCRTKVIDLSE
GISQHAWYPCTISYPYSQLAQTTFWLRVYFSQPMXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXSHDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXCVHFACEAADCPKLAVENASLNCSSSDHYHGAQCTV
RCRTGYVLQIQRDDELIKSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRAFKTQCTQDGSWQEGACVAVTCDPPPA
KFHGLYQCTDGFRFNSECRIKCEDSDAAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXLNSNLKLQCPEGYAIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVVCT
AGLKWYPHPALIHCIKGCEPFMGDNYCDAINNRAFCNYDGGDCCASSVKTKKVTPFPMSC
DIQGDCACRDPQAQEHSRKDLRGYSHG
Download sequence
Identical sequences ENSVPAP00000007707 ENSVPAP00000007707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]