SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007729 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007729
Domain Number 1 Region: 174-270
Classification Level Classification E-value
Superfamily AMPKBI-like 6.41e-35
Family AMPKBI-like 0.00000794
Further Details:      
 
Domain Number 2 Region: 78-161
Classification Level Classification E-value
Superfamily E set domains 1.09e-27
Family AMPK-beta glycogen binding domain-like 0.00000719
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007729   Gene: ENSVPAG00000008309   Transcript: ENSVPAT00000008309
Sequence length 270
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3120:283507:295762:1 gene:ENSVPAG00000008309 transcript:ENSVPAT00000008309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNTSSERAALDRQGGHKTPRRDSSGGSKDGDRPKILMDSPEDADLFHSEEIKAPEKEEF
LAWQHDLEVNGKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPE
GEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELS
SSPPGPYHQEPYVSKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKPI
Download sequence
Identical sequences XP_006204862.1.17985 XP_010996955.1.51371 ENSVPAP00000007729 ENSVPAP00000007729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]