SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007747 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007747
Domain Number 1 Region: 28-125
Classification Level Classification E-value
Superfamily Immunoglobulin 6.43e-18
Family I set domains 0.013
Further Details:      
 
Domain Number 2 Region: 170-221
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000034
Family EGF-type module 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007747   Gene: ENSVPAG00000008326   Transcript: ENSVPAT00000008329
Sequence length 638
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2173:492736:715125:1 gene:ENSVPAG00000008326 transcript:ENSVPAT00000008329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSERREGRGKGKGKKDRGSGKKPRPALPPRLKEMKSQESAAGSKLVLRCETSSEYSSLKF
KWFKNGNELNRKNKPQNIKIQKRPGKSELRISKASLADSGEYTCKVTSKLGNDSASANIT
IVDSNEISTGMPASTERAYVSSESPIRISVSTEGANTSSSTSTSTTGTSHLVKCAEKEKT
FCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKHLGIEFMEAEELYQ
KRVLTITGICIALLVVGIMCVVAYCKTKKQRKKLHDRLRQSLRSERNNMVNMANGPHHPN
PPPENVQLVNQYVSKNVISSEHIVEREAETSFSTSHYTSTAHHSTTVTQTPSHXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXVSAMTTPARMSPVDFHTPSSPKSPPSEMSPPVSSTTMSMPSMAISPFVEEERPLLLV
TPPRLREKADHPPQQFNSFHCNPAHESNSLPASPLRIVEDEDYETTQEYEPAQEPAKKLT
NSRRAKRTKPDGHVANRLEMDSHTSAESSDSESETEDERVGEDTPFLGIQNPLAASLEAA
PAFRLADGRTNPAGRFSTQEELQARLSSVIANQDPIAV
Download sequence
Identical sequences ENSVPAP00000007747 ENSVPAP00000007747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]