SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007802 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007802
Domain Number 1 Region: 165-180,207-510
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.29e-98
Family Myeloperoxidase-like 0.0000000000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007802   Gene: ENSVPAG00000008387   Transcript: ENSVPAT00000008387
Sequence length 510
Comment pep:novel genescaffold:vicPac1:GeneScaffold_3690:73738:80592:-1 gene:ENSVPAG00000008387 transcript:ENSVPAT00000008387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGSSPKCTVAFGPYWAWGLVAEMKLPLALAGLLASLAMLQPSGGATPAVPREVETSVVL
TCMEEAKRLVDKAYKERRESIKQRLRSGSASPMELLSYFKQPVAGTRTAVRAADYLHVAL
GLLERKLRSLWPGPFNVTDVLTPVQLNLLSKTSGCAYQDLAVRCPEKDKYRTITGQCNNR
CSLCALRVGSQQPGATWSQRPVLPCRRSPTLGASNRAFVRWLPAEYEDGFSLPFGWTPGV
KRNGFQVPLTRAVSNDIVRFPTDQLTPDQERSLMFMQWGQLLDHDLNFTPEPAARVSFLT
GLNCDTSCLQQPPCFPLKIPPNDPRIKNQRDCIPFFRSCPACTGSNITIRNQINALTSFV
DASMVYGSEDPLAMRLRNLTNQLGLLAVNTRFQDNGRALLPFDNLHDDPCLLTNRSAQIP
CFLAGDSRSSEMPELTSMHTLLLREHNRLATKLKRLNPRWDGERLYQEARKIVGAMVHII
TYRDYLPLVLGPEAMRKYLPKYRSYNDSVD
Download sequence
Identical sequences ENSVPAP00000007802 ENSVPAP00000007802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]