SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007910 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007910
Domain Number 1 Region: 54-181,212-329
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.96e-43
Family FAD/NAD-linked reductases, N-terminal and central domains 0.06
Further Details:      
 
Domain Number 2 Region: 619-693
Classification Level Classification E-value
Superfamily EF-hand 9.45e-18
Family Calmodulin-like 0.015
Further Details:      
 
Domain Number 3 Region: 310-404
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000569
Family D-aminoacid oxidase-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007910   Gene: ENSVPAG00000008498   Transcript: ENSVPAT00000008498
Sequence length 727
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_955:37574:152853:1 gene:ENSVPAG00000008498 transcript:ENSVPAT00000008498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFQKAVKGTILVGGGAVATVLGLSQFAHYRRKQVNLAFVEAADCVSEPVNREPPSREAQ
ILTLKNTSEFDILVIGGGATGSGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMKLDIEQYRLVKEALHERANLLEIAPHLSAPLPIMLPIYKWWQLPYYWVGIKLY
DLVAGSNCLKSSYVLSKSRALEHFPMLQKAWLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYMEVVSLLKKTDPQTGKERVSGARCKDVLTGQEFDVRAKCVINATGPFTDTVRKM
DDKNAAAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDTPTD
VTHHPVPSEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNH
VVDISESGLITIAGGKWTTYRSMAEDTINAAVKTHDLKAGPSRTVGLFLQGGKDWSPTLY
IRLVQDYGLESEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVKYG
VKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGKELHWDDSKKKEELETARKFLY
YEMGYKSRSEQLTDRSEISLLPSDIDRYKKRFHKFDADQKGFITIVDVQRVLESIGVQMD
ENTLHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPV
DRSCGGL
Download sequence
Identical sequences ENSVPAP00000007910 ENSVPAP00000007910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]