SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000008051 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000008051
Domain Number 1 Region: 394-426,507-551
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000104
Family Anti-sigma factor antagonist SpoIIaa 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000008051   Gene: ENSVPAG00000008646   Transcript: ENSVPAT00000008646
Sequence length 552
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_463:2164755:2184331:-1 gene:ENSVPAG00000008646 transcript:ENSVPAT00000008646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVLSMMVGAAVVRFTSTDETGDSMVSNSSMSKDSSLLDERKVLVAASITVLSGIIQLLMG
VLQLGFVVIYLSESLISGFTTAAAIHVLVSQLKFILQLTVPAHTDPFSIFKVLISVFSQI
EKTNIADLVTSLIILVIVSVFKEINQRFKAKLPVPIPIELIVTVIAAGVSYGCDFKNRFN
VAVIGEMKRGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXSVLAALALGNLKGMLMQFSEIRRLWRKDKYDCLIWVMTFILAVVLGLGLGLAASVAF
QLLTIVFRTQFPKCSTLANVGRSNIYKNRKDYLEMYEPEGVKIFRCPSPIYFANIGFFKQ
KLIDAIGFSPLRVLRKRNKALKKIRKLQKKGLLQVTSKGFVSTLDDFKDSDDELDDKTEE
LDQPINTTDLPFQIDWNADLPVNIVVPQINMHSLILDFSAVSFLDVSSMGGLKTILQEFI
RIQVDVYIVGTD
Download sequence
Identical sequences ENSVPAP00000008051 ENSVPAP00000008051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]