SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000008337 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000008337
Domain Number 1 Region: 85-211
Classification Level Classification E-value
Superfamily E set domains 1.68e-42
Family RhoGDI-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000008337   Gene: ENSVPAG00000008961   Transcript: ENSVPAT00000008962
Sequence length 213
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2918:38921:44337:1 gene:ENSVPAG00000008961 transcript:ENSVPAT00000008962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSNSKAASAGSAAGPGELVAGWEDINKAGGRVLNRLKARLQAPHHTTDDDFLSVFEHD
LLGLFFIRAELFLRLXXXXXXYLCKPEDNVYSIDFTRFKIRDLETGTVLFEIAKPCVSDQ
EEEEEEAGGDVDVSAGRFVRYQFTPAFLRLRTVGATVEFTVGDKPVSNFRMIERHYFRER
LLKTFDFDFGFCIPSSRNTCEHIYEFPQLSEDV
Download sequence
Identical sequences ENSVPAP00000008337 ENSVPAP00000008337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]