SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000008477 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000008477
Domain Number 1 Region: 84-297
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.11e-82
Family Transglutaminase core 0.000000326
Further Details:      
 
Domain Number 2 Region: 2-83
Classification Level Classification E-value
Superfamily E set domains 1.78e-20
Family Transglutaminase N-terminal domain 0.0022
Further Details:      
 
Domain Number 3 Region: 526-617
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.1e-19
Family Transglutaminase, two C-terminal domains 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000008477   Gene: ENSVPAG00000009107   Transcript: ENSVPAT00000009107
Sequence length 645
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1275:62762:85942:-1 gene:ENSVPAG00000009107 transcript:ENSVPAT00000009107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NNPEVGKGTHVIIPVGKGGSGGWKAQVTKSSGNNLNLRVHTSPNAIIGKFQFTVRTHSEA
GEFQLPFDPRNEIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNY
GQFDHGVLDACLYILDRRGMPYGGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGT
NPSAWVGSVEILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTS
LTLDIYFDENMKPLHLNYDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLGAAVVGQECEVQI
VFKNPLPVTLTNVVFRLEGSGLQRPKVLNVGXXXXXXXXXXXXXXXXXRPGPRQLIASLD
SPQLSQVHGVIQVDVAPAAGGGGFSDAGGDSHSGETIPMASRGGA
Download sequence
Identical sequences ENSVPAP00000008477 ENSVPAP00000008477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]