SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000008539 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000008539
Domain Number 1 Region: 4-225
Classification Level Classification E-value
Superfamily MFS general substrate transporter 5.75e-32
Family Glycerol-3-phosphate transporter 0.059
Further Details:      
 
Domain Number 2 Region: 310-420
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00000000000000366
Family Glycerol-3-phosphate transporter 0.046
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000008539
Domain Number - Region: 248-281
Classification Level Classification E-value
Superfamily Plexin repeat 0.0288
Family Plexin repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000008539   Gene: ENSVPAG00000009173   Transcript: ENSVPAT00000009173
Sequence length 462
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1646:898296:1208323:-1 gene:ENSVPAG00000009173 transcript:ENSVPAT00000009173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IASMTVPVYIAEVSPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQKDGWRYMLGLAA
IPAVIQFFGFLFLPESPRWLIQKGQTQKARRILSQMRGNQTIDEEYDSIKNNIEEEEKEV
GSAGPVICRMLSYPPTRRALIVGCGLQMFQQLSGINTIMYYSATILQMSGVEDDRLAIWL
ASVTAFTNFLFTLVGVWLVEKVGRRKLTFGSLAGTTIALIILALGFLLSAQVSPPITLKP
VAPPGQNTTCTRYSYCDECMLDPDCGFCYKMNKSIVIDSSCVPVNKASTNEAAWGRCENE
TKFKTEEVFWAYNFCPTPYSWTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWARSTGNA
CSSGINWIFNVLVSLTFLHTAEYLTYYGAFFLYAGFAAVGLLFIYGCLPETKGKKLEEIE
SLFDNRLCTCGASDSDEGRYIEYIRVKGSNYHLSDNDASDVE
Download sequence
Identical sequences ENSVPAP00000008539 ENSVPAP00000008539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]