SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000008545 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000008545
Domain Number 1 Region: 802-1086
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.79e-76
Family Complement components 0.0000228
Further Details:      
 
Domain Number 2 Region: 1170-1297
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 3.4e-31
Family Alpha-macroglobulin receptor domain 0.002
Further Details:      
 
Domain Number 3 Region: 637-689
Classification Level Classification E-value
Superfamily E set domains 0.0000000021
Family SVA-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000008545   Gene: ENSVPAG00000009180   Transcript: ENSVPAT00000009180
Sequence length 1337
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2157:7384:118531:1 gene:ENSVPAG00000009180 transcript:ENSVPAT00000009180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKFLVTAPGIIRPGRNVTSGVELLEHSPSQVTVKVELVKMSANLTVSVLEAEGVVFEKGS
LKTLTLPSLPLSSADEIYELRVTGRAQDEILFANSTRDPKSNLVQQWLSEQSDLGVVSKT
FQLSSHPILGDWSIQVQVNDQTYYQSFQVSEYYMYGKPVKGDMTLTFLPLSFGVNITKAF
EIDGSANFSFNDEEMEKVMDFSDGPSHVYLSPAGPVEILAVVTESLTGISRSTSSSVFFK
QHDYIIELFDDATVLKPSLNFTATXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXVVHELELYNTGYYLGMFMNSFAVFQECGLWVLTDAN
LVKDDIDGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLQAFQPFFIFLNIPYSVIRGEEFA
LEVTIFNYLKDTTEVKVIIEKSDDFDILMASNEINATGHQQTIQVPSEDGVTVLFPVRPT
HLGEIPVTVTAVSPAASDAVTQRLLVKAEGIEKSYSQSILLDLADSRRQTTLKTLGFSFP
PHTVSGSERVQITAIGDILGSSINGLASLIRMPYGCGEQNMINFAPNIYVLDYLTKEKQL
TDLGEKALSFMRQGYQRELLYQREDGSFSAFGNDDPSGSTWLSAFVLRCFLEADPYIDID
QNVLHRTYTWLQGRQKSSGEFWEPGRVIHSELQGGNKSPVTLTAYIVTSLLGYKKYQPNI
DVQEPVNFLESEFDRGIPDNYTLALVTYALSSVGSPKAKEALNMLMGRAEQEGGMQFWVS
SVSKLSESWQPSSLDIEVAAYALLSHFLQHQAAEGVPIMRWFSANSFRGFASTQDTIVAL
KALSESAALMNTERTNLQVTVMGSSPSPVKFLIDTQNRFVLQTAELAVVQPMAVNISASG
FGFAICQLNIIYNVKASGSSRVRKSIQDQEAFDLDVAIKDNEDDINHLDLNVCTRFLGPT
RSGMALMEVNLLSGFTVPSDAIPLSETLKKVEHDHGKLNLYLDSVNETQFCVDIPAVRNF
KVSNTQDASVSIVDYYEPRRRAVRSYNSRAKLSFCDLCGDTQGCGLCDSAASASPSPPPA
SLLFCFTLLFSLQSWLR
Download sequence
Identical sequences ENSVPAP00000008545 ENSVPAP00000008545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]