SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000008561 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000008561
Domain Number 1 Region: 992-1129,1166-1303
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 4.24e-43
Family Complement components 0.00089
Further Details:      
 
Domain Number 2 Region: 1523-1585
Classification Level Classification E-value
Superfamily TIMP-like 0.00000000000188
Family Netrin-like domain (NTR/C345C module) 0.00014
Further Details:      
 
Domain Number 3 Region: 1631-1673
Classification Level Classification E-value
Superfamily TIMP-like 0.00000133
Family Netrin-like domain (NTR/C345C module) 0.0003
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000008561
Domain Number - Region: 818-850
Classification Level Classification E-value
Superfamily E set domains 0.0742
Family SVA-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000008561   Gene: ENSVPAG00000009197   Transcript: ENSVPAT00000009197
Sequence length 1674
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_750:68458:162217:-1 gene:ENSVPAG00000009197 transcript:ENSVPAT00000009197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIWGILCFLIFLGKSWGQEQTYVISAPKVFRVGASENIVIQVYGYTEAFDATISIKSYP
DKKFTYSSGYVSLSTENKFQNSALLTIQPKQLSGGQNPVSHVYLEVVSKHFSKSKKVPVT
YDNGFLFIHTDKPVYTPHQSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXYGVWKIKAKYKEDFSTTGTAYFEIKEYVLPHFSVSIEPENNFIGY
KDFNNFEITIKARYFYNKVVNEAEVYISFGIKEDINDELKEMMPKAMRNTMLVNGVAQVT
FNSETAVKELSYESLEELNNKYLYIGVTVIESTGGFSEEAEIPGIKYVLSPYKLNLVATP
LFVKPGIPYSVKVQVKDSLDQLVGGVPVTLSAQTLDINQETSDLELKESVTRSSDGVALF
VVNLPSEVTVLEFNVRTQDPDLPEENQASKDFRAIAYSSLSQSYLYIDWTENYKPLLVGE
HLNIVVTPRSPYIDKITHYNYLILSKGKIVHFGTREKLSDSAYQSVNIPVTQNMVPSARL
LVYYIVTGEQTAKLVSDSVWLTIEEKCGNQLQVHLSPSREAYSPGDHVTLNMATESASWV
ALTAVDSAIYGVQKTIKKPLERVFQTLEKSDLGCGAGGGHTNAEVFYLAGLTFLTNANAD
DAQENDEPCKEILRPKRMLQKKIEEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIKALLAVTKPEIRSYFPESWLWEVHHV
SKXXXXXXXXXXXXXXXXXXXXXXXXXXICVADTLKAKVFKDVFLEMNIPYSVVRGEQIQ
LKGTVYNYRTSGMVFCVKMSPVEGICSSGSPGIDPQGKSSSKCVPQRIEGSSSHAVTFSI
LPLEIGLHNINFSLETSFGNEILVKTLRVVPEGVKRESFAGITLDPRGIYGVISRRKEFP
YRVPLDLVPKTKVERVVSVKGLLLGEIMSAVLSQEGIDTLTHLPKGNAEAELMSIVPVFY
VFHYLEAGDNWNIFSPKSLTQKQNLEKKLKEXXXXXXXXXXXXXXXXXXXXXXXXXXLTA
FALRVLGQVNKYVAQNQNSICNSLLWLIENCQLENGSFKENSEYQPIKLQXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXKISTALKAETFLLENTLSTQSTFTLAIAAYALSLGDKT
HPQFRSIVLALKKEALVKGNPPIYRFWKGSLQQKDSSAPNAGTAQIVETTAYALLTSLSL
KEMNYVNPIIKWLSEEQRYGGGFYSTQDTINAIEGLTEYSLLVKKLRLDMDVKVSYKHKG
DIYQYKITERNFLGRPVEVPLNDDLVVLSTGQNNGLATVHVKTVVHKTSTSEEICSFHLK
IETQDIEVSSYSYSDYKRIVACAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXK
QCTMFYSTSDTKLQKVCEGVTCKCVEADCGQMQTELDLTISADTRKETACKPEIAYAYKV
KIIAVTEENAFVKYTATLLDIYKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXYIHPLDSSTWIEYWPTGTGCPSCQAFLANLDEFTEDIFLNGCE
Download sequence
Identical sequences ENSVPAP00000008561 ENSVPAP00000008561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]