SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000008608 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000008608
Domain Number 1 Region: 525-562
Classification Level Classification E-value
Superfamily E set domains 0.00000129
Family SVA-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000008608   Gene: ENSVPAG00000009246   Transcript: ENSVPAT00000009245
Sequence length 563
Comment pep:novel genescaffold:vicPac1:GeneScaffold_870:27682:46073:-1 gene:ENSVPAG00000009246 transcript:ENSVPAT00000009245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPQNNRIFQWHNVTSFHNITELSFQLISEPMFGDYSIIVHRKSGKTLTHQFTVNRHVLPK
FEVKVSAPKTVTISDDEFQVAACAKYTFGQPVQGRGQIRVCREFPSSGNCEKDSNEICEQ
FVAQVRINLCSSCLTGVQISEKSSVSITQVLGSVSFENMVPFYRRGISYFGTLKFSGPNN
VPMVNKLLQLELNDKFVGNYTTDENGEAQFSIDTSEMFDPEFSLKVRADECYLPSWLTPT
YSEGYFPVRRFYSRTNSFLTIVPETKQLRCDQQEVVTVYYSLNSEAHSGDSGINFFYLKG
NFSFPIDVSADLAPVAFMLVYTLHPDGEIVADSVRFQVEKCFKNKVSMKFSKEQGLPGSS
THLQLQAAPDSFCALRAVDKSVLLLTSELQLSAETVSFVYNLLPNTELYGYLYHGLNLDD
GKLDPCIPQKDMFYNGLYYTPVSNHGDGDAYNVVRVRSFKILKAMIETVRTNFPETWIWD
LVSVDSSGSANLSFVIPDTITQWEASGFCVNGEAGFGIASAVTLEVSQPFFVEMTLPFSV
VRNEQSDLLVSVFNYLNTCVEVS
Download sequence
Identical sequences ENSVPAP00000008608 ENSVPAP00000008608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]