SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000008613 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000008613
Domain Number 1 Region: 131-438
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2e-35
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000197
Further Details:      
 
Domain Number 2 Region: 467-578
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 6.36e-30
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000538
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000008613   Gene: ENSVPAG00000009250   Transcript: ENSVPAT00000009250
Sequence length 582
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3427:50484:111249:1 gene:ENSVPAG00000009250 transcript:ENSVPAT00000009250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLVGLLWAGGGGGHGPVPGGMQLGRRKLEGRRTSRPAAGGKLRPPLLLCTEDGRGLERA
LSELTSETDVPVVFVGRRKLGGHGPTLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXEAAKYNKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQAL
RDSRNYGWNVEETVKHDWERMTEAVQNHIGSLNRGYRVALREKKVTYENAYGQFVGPHKI
KATNNKGREKIYSAEKFLIATGERPRYLDIPGDREYCISSDDLFSLPYCPGKTLVVGASY
VALECAGFLAGIGLDVTVMVRSILLRGFDQDMANRIGEHMAEHGVKFIRQFVPIKVEQIE
AGTPGRLRVVAKSTNGDTTIEEEYNTVLLAIGRDACTRKIGLETVGVKINEKTGKIPVTD
EEQTNVPYIYAIGDVLEGKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEY
GACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIVCNIKDNERVVGFHM
LGPNAGEVTQGFAAALKCGLTKDQLDSTIGIHPVCAEFSSSQ
Download sequence
Identical sequences ENSVPAP00000008613 ENSVPAP00000008613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]