SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000008663 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000008663
Domain Number 1 Region: 395-419
Classification Level Classification E-value
Superfamily Notch domain 0.0000654
Family Notch domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000008663
Domain Number - Region: 458-485
Classification Level Classification E-value
Superfamily Notch domain 0.00902
Family Notch domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000008663   Gene: ENSVPAG00000009308   Transcript: ENSVPAT00000009311
Sequence length 1204
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_865:4971:78635:-1 gene:ENSVPAG00000009308 transcript:ENSVPAT00000009311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVLEWSQDQYHVLFDSYRDNIAGKSFQNRLCLPMPIDVVYTWVNGTDLELLKELQQVREQ
MEEEQKAMREILGKNTTEPTKKSEKQLECLLTHCVKVPMLVLDPALPASIMLKDLPALYP
SFHSASDIFNVAKPKNPSTNVSVVVFDSTKSVEDAHSGMLKGNNKQTVWRGYLTTDREVP
GLVLMQDLAFLSGFPPTFKETNQLKTKLPENLSLKIKQLQLYSEASVALLKLNNPEDFQE
LNKQTKKNMTIDGKELTISPAYLLWDLSAISQSKQDEDVSASRFEDNEELRYSLRSIERH
APWVRNIFIVTNGQIPSWLNLDNPRVTIVTHQDVFRNLSHLPTFSSPAIESHIHRIEGLS
QKFIYLNDDVVWKDVGQTVYLTWPVPNCAEGCPGSWIKDGYCDKACNNSACDWDGGDCSG
NSGGSRYMAGAVGTGSFGAGQPWHFGGAIRGVSYCNQGCANSWFPDKFCDQACHVLSCGF
DAGDCGQDHFHELYKVTLLPNQTHYVIPKGECLPYFSFAEIAKRGIEGIYNDNPIIRHAS
IANKWKTIHLIMHSGMNATTIHFNLTFQSTNDEEFKMQIAVEVDTREEPKWNSTTQKPRQ
NLVSPALLPEAEVLFEDIPEEKRFPKVKRHDVNTTGRVQVEVEIPLLNISLPKXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLTGLEHMLINCSKMLPANITQLNTIP
PTQEAYYDPNLPPVTKSLVTNCKPVTDKIHKAYKDKNKYRFEIMGEEEIAFKMIRTNVSH
IVGQLDDIRKNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXRAYRDKLKFWTHCVLATLIMFTIFSFFAEQLIALKRKIFPRRRIHKEASPD
QIRV
Download sequence
Identical sequences ENSVPAP00000008663 ENSVPAP00000008663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]