SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009404 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000009404
Domain Number 1 Region: 483-835
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.54e-110
Family PDEase 0.000000278
Further Details:      
 
Domain Number 2 Region: 61-226
Classification Level Classification E-value
Superfamily GAF domain-like 1.34e-27
Family GAF domain 0.0005
Further Details:      
 
Domain Number 3 Region: 345-458
Classification Level Classification E-value
Superfamily GAF domain-like 1.69e-20
Family GAF domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009404   Gene: ENSVPAG00000010108   Transcript: ENSVPAT00000010108
Sequence length 858
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1617:485274:548709:1 gene:ENSVPAG00000010108 transcript:ENSVPAT00000010108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEISQETVEKYLEDNPQFAKEYFDKKLRAEAPGEISERAHVPASASFPGLTLAEEAALC
LELLGVLREEAGSAELAVHRALQRLVRLVQADRCSMFLCRARNGTPEVASKLLDVTPTSR
FEDNLVVPDKEAVFPLDVGIVGWVAHTKKTFNVPDVKKNNHFSDFMDKQTGYVTRNLLAT
PITMGKEVLAVVMAVNKVEAAEFSKQDEEVFSKYLNFVSVILKLHHTNYLYNIESRRSQX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEFYDEWPVKLGEVE
PYKGPKTPDGREVIFYKIIDYILHGKEEIKVIPTPPADHWTLVSGLPTYVAENGFXXXXX
XXXXXXXXXXXKGPVDETGWVIKNVLSLPIVNKKEDIVGVATFYNRKDGKPFDEYDEHIT
ETLTQFLGWSLLNTDTYEKMNKLENRKDIAQEMLMNHTKATPEEIKSILKFKEKLNIDAI
EDCEEKQLVTILKEDLPDPRAADLYEFRFSDFPITEHGLIQCGLRLFFEINVVEKFKVPV
EVLTRWMYTVRKGYRSVTYHNWRHGFNVGQTMFTLLMTGRLKKYYTDLEAFAMLAAAFCH
DIDHRGTNLYQMKSTSPLARLHGSSILERHHLEYSKTLLQDESLNIFQNLNKRQFETVIH
LFEVAIIATDLALYFKKRTMFQKIVDACEKMETEEEAIKYVTIDPTKKEIIMAMMMTACD
LSAITKPWEVQSQVALLVANEFWEQGDLERTVLQQQPIPMMDRNKKDELPKLQVGFIDFV
CTFVYKEFSRFHKEITPMLNGLQNNRVEWKTLADEYDEKMKVLEEETKKHEEGNTTEKAA
EDTGGGGDDKKSKTCLML
Download sequence
Identical sequences ENSVPAP00000009404 ENSVPAP00000009404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]