SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009413 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000009413
Domain Number 1 Region: 23-140
Classification Level Classification E-value
Superfamily Chromo domain-like 6.5e-16
Family Chromo domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009413   Gene: ENSVPAG00000010117   Transcript: ENSVPAT00000010117
Sequence length 143
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_379:71281:75043:-1 gene:ENSVPAG00000010117 transcript:ENSVPAT00000010117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKNNQKKVEEVLDEEEEVVEKVDRRVEGKVYLKWKGFSDEDNTWEPEENLDCPDLIAEF
LQSQKTAHETDKSEAGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATD
SSGELMFLMKWKNSDEADLVPAK
Download sequence
Identical sequences ENSVPAP00000009413 ENSVPAP00000009413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]