SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009414 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000009414
Domain Number 1 Region: 308-581
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.13e-90
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000207
Further Details:      
 
Domain Number 2 Region: 123-262
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.83e-41
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00038
Further Details:      
 
Domain Number 3 Region: 583-657
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.06e-20
Family Anticodon-binding domain of Class II aaRS 0.0029
Further Details:      
 
Domain Number 4 Region: 89-121
Classification Level Classification E-value
Superfamily TGS-like 0.0000219
Family TGS domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009414   Gene: ENSVPAG00000010118   Transcript: ENSVPAT00000010118
Sequence length 659
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_917:90487:107241:1 gene:ENSVPAG00000010118 transcript:ENSVPAT00000010118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGAGEENQKEGGKNKEASGDGGRAELSPWPEYINTRLEMXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLADNTVIAKVNEVVWDLDRPLEEDCTLEL
LKEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEEGGVSSNDFSSL
EALCKKIIKEKQAFERLEVKKETLLEMFKYNKFKCRILNEKVNTPTTTVYRCGPLIDLCR
GPHVRHTGKIKALKIHKNSSTYEGKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXDQELYFFHELSPGSCFFLPKGAYIYNMLIEYIRSEYRKRGFQEVVTPNIYNSRLW
VTSGHWQHYSENMFSFEVEKEQFALKPMNCPGHCLMFDHRPRSWRELPLRVADFGVLHRN
ELSGALTGLTRVRRFQQDDAHIFCAMEQIESEIKGCLDFLRAVYNVFGFSFKLNLSTRPE
KFLGDVEVWNQADKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQL
DFQLPIRFNLTFVSHDGDDKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQVMV
VPVGPTCDEYAQKVRQQFHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKT
Download sequence
Identical sequences ENSVPAP00000009414 ENSVPAP00000009414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]