SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009502 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000009502
Domain Number 1 Region: 1033-1161
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000785
Family GAF domain 0.014
Further Details:      
 
Domain Number 2 Region: 293-349,868-913
Classification Level Classification E-value
Superfamily EF-hand 0.0000004
Family Calmodulin-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009502   Gene: ENSVPAG00000010211   Transcript: ENSVPAT00000010211
Sequence length 1504
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2262:441015:515727:1 gene:ENSVPAG00000010211 transcript:ENSVPAT00000010211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESASQEEPKPAQENGKEDKEGKQEVTEVKEPIKSQSILDSSALGTCSHVAGAAANKSK
SQELNLEGQSDISRCSIKDSNTGASKNTVYRKPAKVIFHLDQTAKPEQPWKKNLFERLQA
RTQAMQQKIIDKENLKKELEKKAEKNLPKDNLAKEWFNTENMTLNTRAYLLDKLLPTLVP
GVEKTLMQVEKKKILAEVDIPTKFDPINHLGEYLMRNNPNYIKDSGMSGYQRVMRDVTED
LKIYVPNTIYNRVSKMKENVKQKREQREHLNKVKANVANTRKQALQEQFTEWILDPKGMI
PMAVIQNVLHEFFQNPDFQLEECCKELDITDSMEPRLNKMEFIEFISSHIADFKSEMFEE
LLKHLCHYAEEFREVIKTDMRKQMFAELFLHCDRGKVGFLDRQRTLALLETFYDQSSEVL
RSLLRNPRQWPFIEFGEIDLPEFWGDMDNQKHIYEDFDNVLLEMNILLSNKHASKTQSKL
LANLEDQHKHDERRKSTLPQSPPEQQRGTTVEQEPDRISTKEQEQDRESTGDQELYKESV
AKQGTYTGSTPEQGSGTELITEQTPHSESTAKQGLYRESIIAQGQYERSTTGQGSHRESV
IEQEGPHRESPEEQGPSRESVIEQGPHRGSSAGLRPRRESVTGQGPRRGSTAEQQPHRET
IPEKQQDIDSTSQSRKSGILIESKKSREDISFEDIKVPPQEERTQEQIYEEHLFMNSELQ
EKISVSNRKSHLSETAKKEVQKDKSCEPKSQKIEGKSWSGELLTCTWNTKYAKCEDEEQA
NLIYGNSRFTDLHAIIRNIQSYKEVKGRSAFNGVSFNLLQFVQLLETFVGEDAPLSVSEA
LTSFFKKGFVETKEEKISALEQARQNASRVRRELLLKALFQKWDSDGSGFLDLKEVDELL
YTYKEGMEKESMKKAKLHIQFPKPHPGHEVKLSSKQFQKYIELVVSELRGNEDQVLESIV
EFLMNTLERNHAESLRNCARQKWLHQIQYSAETSGVSLEPVYTETFKALTQDAEAHGNKK
ISAHISLLEENLLLPDRGNVMLRNVACTLDDAPFVLNRVLYRDMKGISFTVVDEGKPIHV
PQVQHHGNIFFWNYSRKKNDQNGSFLALPLQDAHMRIFGVLAVDTLRDPKKINIFLPHEI
RFYQGVANVFSTAYHYVHSREHILHIVITGIGWLYNITSSITAITTYFIEPNPEQDSDYV
LRNMMVTGHLGLPEFHXXXXXXXXXXXXXXDFLFKCTDSSEVVLASVCGENHIVVPLRER
TGEALGILDFNIGRSKMLLYREFKDLQKMMKVIQVACFEILGELSGEIKKNYILEIENVG
EVQRAGILFFRVMLQELQECLRLLTSMDFVSLLLFDYNPLEEPKSPPDSKSQELEANIKL
VQDILKGIILFFHPELELSSDLENWEKCKLCIDRYLVQNICDFDPTAGHVEVNLKLIDEY
IKDHSRIEVWKFGNTAIEYLYQWAHVCLALVKLNKKINSAITPPLPSKTDSYVYAKMPGE
SLQG
Download sequence
Identical sequences ENSVPAP00000009502 ENSVPAP00000009502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]