SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009664 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSVPAP00000009664
Domain Number - Region: 117-148
Classification Level Classification E-value
Superfamily HR1 repeat 0.0863
Family HR1 repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009664   Gene: ENSVPAG00000010386   Transcript: ENSVPAT00000010386
Sequence length 273
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2935:44541:57093:1 gene:ENSVPAG00000010386 transcript:ENSVPAT00000010386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ICPICAALPGGDPNHVTDDFAAHLTLEHRAPRDLDESSGVRHVRRMFHPGRGLGGPRARR
SNMHFTSSSAGGLSSSQSSYSPSXXXXXXXXXXELLSQLSGVRRSAGGQLNSSGPSASQL
QQLQMQLQLERQHAQAARQQLETARNATRRSNASSVTAAVTQSTATASTANTDSSQQALQ
NSQFLLTRLNDLKLSEAEPQCMESEPDRSLFVQELLLSTLVREESSSSDEEEPGEMADFG
AMGCVDIMPLDVALENLNLKESNKGNEPPPPPL
Download sequence
Identical sequences ENSVPAP00000009664 ENSVPAP00000009664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]