SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009868 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000009868
Domain Number 1 Region: 3-166
Classification Level Classification E-value
Superfamily E set domains 6.37e-19
Family Arrestin/Vps26-like 0.028
Further Details:      
 
Domain Number 2 Region: 159-300
Classification Level Classification E-value
Superfamily E set domains 0.000000000000154
Family Arrestin/Vps26-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009868   Gene: ENSVPAG00000010604   Transcript: ENSVPAT00000010601
Sequence length 391
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2635:87155:90565:1 gene:ENSVPAG00000010604 transcript:ENSVPAT00000010601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGS
QQCKQTLDYLRYEDTLLLDDQPTGENEMVIMRPGNKYEYKFGFELPEGPLGTSFKGKYGC
VDYWVKAFLDRPSQPTQETKKNFEVMDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVSV
SARIDRKGFCEGDEISIHADFENTCSRIVIPKAAIVARHTYLANGQTKVLTQKLSSVRGN
HIISGTCASWRGKSLRVQKIRPSILGCNILRVEYSLLIYVSVPGSKKVILDLPLVIGGRS
GLSSRTSSMASRTSSEMSWVDLNIPDTPEAPPCYMDIIPEDHRLESPTTPLLDDTDGSQD
SPIFMYAPEFKFMPPPTYTEVDPSILNNNVQ
Download sequence
Identical sequences XP_006212509.1.17985 ENSVPAP00000009868 ENSVPAP00000009868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]