SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010038 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010038
Domain Number 1 Region: 2-175
Classification Level Classification E-value
Superfamily E set domains 4.27e-33
Family Arrestin/Vps26-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010038   Gene: ENSVPAG00000010781   Transcript: ENSVPAT00000010780
Sequence length 221
Comment pep:known_by_projection scaffold:vicPac1:scaffold_12655:44518:45695:-1 gene:ENSVPAG00000010781 transcript:ENSVPAT00000010780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APQAGAREKIARSWYSNRGLVSLSAKIDRKGYTPGEVIPVFAEIDNSSTRPVLPRAAVVQ
TQTFMARGARKQKRAVVASLSGEPVGPGRRVLWQGRALRIPPVGPSILHCRVLHVDYALK
VCVDIPGSSKLLLELPLVIGTIPLHPFGSRSSSVGSHASFLLDWGLGVLPEQPEAPPDYS
EVVAVEQSPFPLLQDTDMSVEGPFFTYIQEFRFRPPPLYSE
Download sequence
Identical sequences ENSVPAP00000010038 ENSVPAP00000010038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]