SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010069 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010069
Domain Number 1 Region: 169-364
Classification Level Classification E-value
Superfamily E set domains 9.8e-72
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000000151
Further Details:      
 
Domain Number 2 Region: 64-185
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.27e-20
Family Voltage-gated potassium channels 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010069   Gene: ENSVPAG00000010814   Transcript: ENSVPAT00000010813
Sequence length 500
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1821:741541:862016:1 gene:ENSVPAG00000010814 transcript:ENSVPAT00000010813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQGPQQQLVPKKKRQRFVDKNGRCNVQHGNL
GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY
TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM
FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE
GEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQSEQFEVVIVEG
NVETNGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKEQ
EEMLLMSSPLIAPAITNSKERHNSVECLDGLDDISTKLPSKLQKITGREDFPKKLLRMSS
TTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGGA
ARMEGNLPAKLRKMNSDRFT
Download sequence
Identical sequences ENSVPAP00000010069 ENSVPAP00000010069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]