SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010240 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSVPAP00000010240
Domain Number - Region: 546-577,716-746
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00105
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010240   Gene: ENSVPAG00000010995   Transcript: ENSVPAT00000010998
Sequence length 957
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_881:288260:339074:-1 gene:ENSVPAG00000010995 transcript:ENSVPAT00000010998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMQPERSFQGFGSRFRQNSFPYDVKRDVYNEENFQQEHRRKTASSGNVDIDITTFSHHVQ
CSCSWHKFRRCMLTVFPFLEWMCFYRFKDWLLGDLLAGISVGLVQLPQDLMLSLLARQLI
PPLNVSYAAFCSSVIYAVFGSCHQMSIGSFFLVSALMINVLRIYPFNSGRLVLGTFIRDD
FSNLSFFEGYNKSLSVVASTTLLTGIIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXNIINYCIGLPKANSTSILLFLTAVVALRINRCIRISV
NQYPIEFPMEVFLILGFTAFASKINMATENSKMLIDMIPYSFLFPETPDLSMLTAVILES
FSLAVVSSSLLVFLGRKIAIFHNYDVNSNQDLIAIGLCNVVSSFFRSYVFTGAVIRTVIQ
DKSGGRQQFASLVGAGVMLLLMVKVGRFFYELPNAVLAGIVLSNALPYLETVYNLPNLWR
QNQYDCIAWMVTFISAIFLGLDVGLLVSVAFTFFIITVQSHRTKILLLGQIPNTNIYRSI
HDYREVTNIPGVKIFQCCNSITFVNVYYLKHKLLSEIEMVRVPLTEEEVYALFSQSEDGS
QQQKICRCFCNCDELEPRPRVVYTERFESKRDKYSSSINLIRCSRFESMNTSQSMCDEQV
PYTTSSISQENPTPNYEDVEKVWLSDNSSRLFSTLPEASESQVRDRPPMPYSASSLQPLI
HTIILDFSMVHLVDSQASVVLRQMCNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNEDRHKMSSSLIETPKN
KSPGFSTLQDSVREEESELVLELDRILESEQEPGLDLDLDTDHEMERESELEHESEIQTE
PEPELECRPRAQTYPQQQYWPLYQSLAPNSAPQTPRTQSKTHQHMNSTSKGTTEDPL
Download sequence
Identical sequences ENSVPAP00000010240 ENSVPAP00000010240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]