SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010264 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010264
Domain Number 1 Region: 267-349
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.63e-27
Family Transglutaminase core 0.0000181
Further Details:      
 
Domain Number 2 Region: 524-617
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.02e-25
Family Transglutaminase, two C-terminal domains 0.00000601
Further Details:      
 
Domain Number 3 Region: 82-164
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.12e-21
Family Transglutaminase core 0.00000849
Further Details:      
 
Domain Number 4 Region: 1-80
Classification Level Classification E-value
Superfamily E set domains 5.25e-18
Family Transglutaminase N-terminal domain 0.0000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010264   Gene: ENSVPAG00000011022   Transcript: ENSVPAT00000011024
Sequence length 618
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1381:400810:449826:-1 gene:ENSVPAG00000011022 transcript:ENSVPAT00000011024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAPSEEAGTKARFGLSDAVKEGAWAAAVVDQQDGALSLQLSTPANAPIGLYRLSLEASTG
YQGSSFVLGHFTLLFNTWCPADAVYLDSEEERREYVLTQQGFIYQGSAKFIKNIPWNFGQ
FEDGILDICLMLLDINPKFLKDAGRDCSRRSSPVYVGRVVSGMXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXNFHCWVESWMDRPDLQPGYEGWQALDPTPQKK
SEGTYCCGPVPVRAIKEGDLSTYDAPFVFAEVADVKDWIRQDDGXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXSPEEREAFTRANHLNKRADKEETGVALRIRVGQDMNLG
RGFAHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILGEPKQNRKLVAEVSL
RNPLTVPLSGCAFTVEGAGLTEEQKVVEIPDPVEAGEEVKVRVDLLPMNVGRHKLVVNFE
SDRLKAVKGFRNVIVGPS
Download sequence
Identical sequences ENSVPAP00000010264 ENSVPAP00000010264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]