SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010266 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010266
Domain Number 1 Region: 427-645
Classification Level Classification E-value
Superfamily TPR-like 2.09e-32
Family Tetratricopeptide repeat (TPR) 0.0022
Further Details:      
 
Domain Number 2 Region: 593-811
Classification Level Classification E-value
Superfamily TPR-like 1.44e-24
Family Tetratricopeptide repeat (TPR) 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000010266
Domain Number - Region: 179-248
Classification Level Classification E-value
Superfamily SIS domain 0.0156
Family double-SIS domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010266   Gene: ENSVPAG00000011025   Transcript: ENSVPAT00000011027
Sequence length 914
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2493:627070:671015:1 gene:ENSVPAG00000011025 transcript:ENSVPAT00000011027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADINLKEVTLIIGVVTVCYWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQNDFWGTP
MSEXXXXXXXXXLTVLTFRFKYLFSELKPMSYHLLNMIFHAVVSVIFLKVCKHFLDSRSS
VIASLLFAVHPIHTEAVTGVVGRAELLSSIFFLAAFLSYTKSKGPDNSIVWTPIAVTVFL
VAVATLCKEQGITVVGICCVYEVFIAQGYTLPLLYATAGQFLRGKGSIPFSMLQTLIKLI
VLMFSTLLLVVIRVQVIQSQLPVFTRFDNPAAVSPTPTRQLTFNYLLPVNAWLLLNPSEL
CCDWTMGTIPLIESFLDIRNLATFTFFCFLGALGVFSLRYPGDSSKTVLMALCLMALPFI
PASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQKISNKSVLKKLSWVCLSMVIFTHALK
TLHRNWDWESEYTLFMSALKVNKNNAKLWNNVGHALENEKNFERALKYFLQATHVQPDDI
GAHMNVGRTYKNLNRTKEAEESYMMAKSLMPQIIPGKKYAARIAPNHLNVYINLANLIRA
NESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDKNNADLW
YNLAIVHIELKEPNEALKNFNHALELNPKHKLALFNSAILMQESGEVKLRPEARKRLLSY
INEEPQDANGYFNLGMLAMDDKKDTEAEMWMKKAIKLQADFRSALFNLALLYSHTAKELM
ALPVEELLRYYPDHIKGLILKGDILMNQKKDILGAKKCFEKILEMDPSNVQGKHNLCVVY
FEEKDLLKAERCLVETLALAPHEEYIQRHLNIVRDKISSSSLVEQPIFPASKTSGVGRDK
IPTENVKEIKSEPKPTQIVKTSDNKSQYKSNKQLGKNTDKEVPHKTIKEIKEIEKKRVAA
LKRLEEIERILNGE
Download sequence
Identical sequences ENSVPAP00000010266 ENSVPAP00000010266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]