SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010306 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010306
Domain Number 1 Region: 2-131
Classification Level Classification E-value
Superfamily Lipocalins 5.12e-41
Family Fatty acid binding protein-like 0.000000705
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010306   Gene: ENSVPAG00000011069   Transcript: ENSVPAT00000011067
Sequence length 132
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2410:1026501:1029832:-1 gene:ENSVPAG00000011069 transcript:ENSVPAT00000011067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFDGTWKVDRNENYEKFMEKMGINVVKRKLAAHDNLKLVITQEGNKFTVKESSNFRSIE
IIFELGVTFNYSLADGTEVTGSWSLEGNKLVGKFKRLDNGNELNTVREIIGGEMVQTYTY
EGVEAKRIFKKE
Download sequence
Identical sequences ENSVPAP00000010306 ENSVPAP00000010306 XP_006185574.1.101512 XP_006213986.1.17985 XP_010950900.1.22495 XP_010983834.1.51371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]