SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010392 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010392
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 3.51e-16
Family Sm motif of small nuclear ribonucleoproteins, SNRNP 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010392   Gene: ENSVPAG00000011162   Transcript: ENSVPAT00000011161
Sequence length 65
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_187:82603:86451:1 gene:ENSVPAG00000011162 transcript:ENSVPAT00000011161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLL
QSVSN
Download sequence
Identical sequences A0A091RQX0 A0A091S565 A0A091W1Q6 A0A093HBB6 A0A099ZQ06
ENSMEUP00000013931 ENSVPAP00000010392 ENSMEUP00000013931 ENSVPAP00000010392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]