SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010452 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010452
Domain Number 1 Region: 13-80
Classification Level Classification E-value
Superfamily E set domains 0.0000000000448
Family Arrestin/Vps26-like 0.016
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000010452
Domain Number - Region: 201-254
Classification Level Classification E-value
Superfamily E set domains 0.0609
Family Arrestin/Vps26-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010452   Gene: ENSVPAG00000011226   Transcript: ENSVPAT00000011226
Sequence length 306
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3599:699516:709227:1 gene:ENSVPAG00000011226 transcript:ENSVPAT00000011226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLREPPAGEGILLLQPGKHEFPFSFQLPSEPLVTSFTGKYGSIQYCVRAILERPKVPDQ
SVKRELQVISRIDVNTPALLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXVYIHIPGAKKLMLELPLVIGTIPYNGFGSRNSSTASQFIM
DMSWLTLTLPEQPEAPPNYADVVSEEEFSRHVPPYPQPPNREGESCCPMFACIQEFRFQP
PPLYSE
Download sequence
Identical sequences ENSVPAP00000010452 ENSVPAP00000010452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]