SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010596 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010596
Domain Number 1 Region: 199-401
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 1.12e-31
Family Sec63 N-terminal domain 0.001
Further Details:      
 
Domain Number 2 Region: 412-437,592-676
Classification Level Classification E-value
Superfamily E set domains 1.96e-24
Family Sec63 C-terminal domain-like 0.00074
Further Details:      
 
Domain Number 3 Region: 72-161
Classification Level Classification E-value
Superfamily Chaperone J-domain 9.68e-20
Family Chaperone J-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010596   Gene: ENSVPAG00000011376   Transcript: ENSVPAT00000011377
Sequence length 718
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_182:1929884:2002166:-1 gene:ENSVPAG00000011376 transcript:ENSVPAT00000011377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNRLKNIRKVYGRCMWYRLRLLKPQPNIIPTVXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXGATVAEIKKQYRLLSLKYHPDKGGDEVMFMRIAKAYAALTDEESRKNWE
EFGNPDGPQATSFGIALPAWIVDQKNSILVLLVYGLAFMVILPVVVGSWWYRSIRYSGDQ
ILIRTTQIYTYFVYKTRNMDMKRLIMVLAGASEFDPQYNKDATSRPTDNILIPQLIREIG
SINLKKNEPPLTCPYSLKARVLLLSHLARMKIPETLEEDQQFMLKKCPALLQEMVNVICQ
LIIMARSREEREFRAPTLASLENCMKLSQMAVQGLQQFKSPLLQLPHIEEDNLRRVSNHK
KYKIKTIQDLVSLKESDRHNLLHFLEDEKYEEVMAVLGSFPYVTMDIKSQVLDDEDSNNI
TVGSLVTVLVKLTRQTMAEVFEKEQSICAAEEQPAEDGQSDINKNRTKGGWQQKSKGPKK
AAKSKKKKPLKKKPTPVPLSQPKQQKQKQANGVVGSEAAVKEDEEEVSDKGSDSEEEEAN
RDSQSEKDDGSDRDSDREQDEKQNKDDEAEWQELQQSIQRKERALLETKSKITHPVYSLY
FPEEKQEWWWLYIADRKEQTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRSDS
YMGLDQIKPLKLEVHEAKPVPENHPQWDTAIEGDEDQEDSEGFEDSFEEEEEEEEDDD
Download sequence
Identical sequences ENSVPAP00000010596 ENSVPAP00000010596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]