SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010658 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010658
Domain Number 1 Region: 516-740
Classification Level Classification E-value
Superfamily GFP-like 9.83e-86
Family Domain G2 of nidogen-1 0.000000579
Further Details:      
 
Domain Number 2 Region: 1065-1321
Classification Level Classification E-value
Superfamily YWTD domain 1.1e-45
Family YWTD domain 0.0000000752
Further Details:      
 
Domain Number 3 Region: 877-964
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.1e-21
Family Thyroglobulin type-1 domain 0.00046
Further Details:      
 
Domain Number 4 Region: 972-1042
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.75e-20
Family Thyroglobulin type-1 domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000010658
Domain Number - Region: 838-886
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00144
Family EGF-like domain of nidogen-1 0.099
Further Details:      
 
Domain Number - Region: 477-513
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0156
Family EGF-like domain of nidogen-1 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010658   Gene: ENSVPAG00000011444   Transcript: ENSVPAT00000011445
Sequence length 1333
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3217:71616:149245:-1 gene:ENSVPAG00000011444 transcript:ENSVPAT00000011445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGDRVAGRRALRPPPLLLLLLLLLSRAVALHPGELFPYGLPRGDQLLQEGDDESSAAVK
LALPLRFYDAQFSDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXHSNLGIPGVWAFHIGSTSGLDNVRPATVGGDLSKTHPSAPLGHS
FSHAAALEGDYTEDNLDYYDENEEEVEYPPGEPEEASNGHSTMDVSFHSKADSRQLGESA
TLDPQTKERRPHGDIDTPDLKGRAESSEQPVTPAPPETGDSLGPSREVSPPYPAGGALPA
ETQVPPAHPGREAVLPNYPGLDHAPPPGRGRQVVGVEDDISSNTEVFTYNAAHKETCEHN
HERCSRHAFCTDYATGFCCHCQSRFYGNGKHCLPEGAPHRVNGKVSGQLRVGHTPVHFTD
VDLHAYIVGNDGRAYTAISHIPQPAAQALLPLTPIGGLFGWLFALEKPGWENGFSLTGAT
FIHDMEVTFYPGEERVRITQTAEGLDPENYLSIKTNIQGQVPYIPANFTAHIAPYKELYH
YSDSVVTSTSSRDYSLTFGTINQTQSYRVHQNITYQTCRHAPRRWAVPTTQQLNVDRVFA
LYTDEEKVLRFAVTNQIGPVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIAPPPNP
CEDGSHNCAPAGRARCIHHGGGSFSCACLPGYTGDGHQCTDGFQCTPDPTSGLKPCEHQQ
RDAQAQRTHPGALLHVPQCDEQGHFLPLQCHGSTGFCWCVDPDGREIPGTRTPPGSVPPR
CGPPSEPEPTQRPRTICERWRESLLEHYGGTPRDDQYVPQCDDLGHFTPLQCHGKSDFCW
CVDKDGREVQGTRSQPGTTPACIPTVAPPTVRPTPRPDVAPPPVGTFLLYAQGQQIGHLP
LNGTRLQKDTAKTLLSLHGSIVVGIDYDCRERMVYWTDVAGRTISRASLEAGAEPETIIN
SGLMSPEGLAIDHFRRTMYWTDSGLDKIERAKLDGSERRALFHTDLVNPRAIAVDPIRGN
LYWTDWNREAPKIEMSSLDGENRRILVNKDIGLPNGLTFDPFSKLLCWADAGTKKLECTL
PDGTGRRVIQNNLNYPFSIVSYADHFYHTDWRRDGVISVNRDSGQFMDEYLPEQRSHLYG
ITAVYPYCPTGRK
Download sequence
Identical sequences ENSVPAP00000010658 ENSVPAP00000010658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]