SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010804 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010804
Domain Number 1 Region: 111-291
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.83e-63
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000354
Further Details:      
 
Domain Number 2 Region: 286-419
Classification Level Classification E-value
Superfamily E set domains 3.5e-43
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000398
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010804   Gene: ENSVPAG00000011611   Transcript: ENSVPAT00000011611
Sequence length 437
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2730:2071:35453:1 gene:ENSVPAG00000011611 transcript:ENSVPAT00000011611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DRAMPSRRFTRSSDDPELGALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXTPPPWGCPLGRLVPSAPGPGPRPHLVITEQPK
QRGMRFRYECEGRSAGSILGESSTEASKTLPAIEXRDCGGLREVEVTACLVWKDWPHRVH
PHSLVGKDCTDGVCRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGS
LKNHQEVDMNVVRICFQASYRDQQGQLRRMDPVLSEPVYDKKSTNTSELRICRFNKESGP
CTGGEELYLLCNKVQKEDISVVFSRASWEGRADFSQADVHRQIAIVFKTPPYEDLEIVEP
VTVNVFLQRLTDGVCSEPLPFTYXXXXXXGYGVDKKRKRGMPDVLGDLNSSDPHGIESKR
RRKKPAFLDHFLPSHGS
Download sequence
Identical sequences ENSVPAP00000010804 ENSVPAP00000010804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]