SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010835 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010835
Domain Number 1 Region: 89-235
Classification Level Classification E-value
Superfamily Bactericidal permeability-increasing protein, BPI 0.00000000000000235
Family Bactericidal permeability-increasing protein, BPI 0.013
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000010835
Domain Number - Region: 23-85
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00405
Family Apolipoprotein A-I 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010835   Gene: ENSVPAG00000011648   Transcript: ENSVPAT00000011648
Sequence length 245
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3206:48238:57177:1 gene:ENSVPAG00000011648 transcript:ENSVPAT00000011648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQLWKLVLLCSLLTGTSASLLDHLLKDLNTAVNNLESVLDKGLETVDNRLEPITQELKA
ELGVLQETKSSQEVDQKVENVENLLSDILATAFQIVERITGLKISDISILDIEPELTSDG
NGVTLRIPVTFNISLTLPLFGKIADLSAFFDLQTTVTVETDAETGVSTVVMEECTADLPN
FSLTLLDSRLSLVNKIVNTLAKDLKKIVSLIVKELCPEIQTLVEDLDVNFVNDLIAELQE
ENQQT
Download sequence
Identical sequences ENSVPAP00000010835 ENSVPAP00000010835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]