SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000011010 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000011010
Domain Number 1 Region: 373-629
Classification Level Classification E-value
Superfamily YWTD domain 7.46e-61
Family YWTD domain 0.000000943
Further Details:      
 
Domain Number 2 Region: 1268-1525
Classification Level Classification E-value
Superfamily YWTD domain 7.98e-57
Family YWTD domain 0.0000034
Further Details:      
 
Domain Number 3 Region: 710-913
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-42
Family YWTD domain 0.00000723
Further Details:      
 
Domain Number 4 Region: 963-1144
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-32
Family YWTD domain 0.0000168
Further Details:      
 
Domain Number 5 Region: 197-237
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000262
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 6 Region: 161-199
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 7 Region: 1221-1267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000394
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 8 Region: 3-40
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000772
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 9 Region: 243-279
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000942
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 76-115
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000101
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 11 Region: 37-75
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000524
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 12 Region: 631-668,907-958
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000895
Family Growth factor receptor domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000011010
Domain Number - Region: 1525-1562
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000343
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 289-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000599
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 138-160
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0183
Family LDL receptor-like module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000011010   Gene: ENSVPAG00000011829   Transcript: ENSVPAT00000011830
Sequence length 1818
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_842:465307:502577:-1 gene:ENSVPAG00000011829 transcript:ENSVPAT00000011830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPTCSPLDFHCDNGKCIRRSWVCDGDNDCEDDSDEQDCPPRECEEDEFPCQNGYCIRSLW
HCDGDNDCGDNSDEQCDTRKCSDKEFRCSDGSCIAEHWYCDGDTDCKDGSDEESCXXXXX
XXXXXXXXXXXXXXXXILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCDSGLCINAG
WRCDGDADCDDQSDERNCTTSMCTAEQFRCRSGRCVRLSWRCDGEDDCADNSDEENCENT
GSPQCASDQFLCWNGRCIGQRKLCNGVNDCGDNSDESPQQNCRPRTGEENCNVNNGGCAQ
KCQMVRGAVQCTCHTGYRLTDGRMCQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHRRELVFWSDVT
LDRILRANLNGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKVL
LWQNLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWPNGLTIDYA
GRRMYWVDAKHHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSANK
FTGKNQEIIRNKLHFPMDIHTLHPQRQPAGKNRCGDNNGGCTHLCLPSGQNYTCACPTGF
RKISSHACAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDWDSRDDHVY
WTDVSTDTISRAKWDGTGQEVVVDTSLESPAGLAIDWVTNKLYWTDAGTDRIEVANTDGS
MRTVLIWENLDRPRDIVVEPMGGYMYWTDWGASPKIERAGMDASGRQVIISSNLTWPNGL
AIDYGSQRLYWADAGMKTIEFAGLVLIGSQLPHPFGWTLYGERIWTDWQTKSIQSADRLT
GRDRETEQENLENLMSTPCAMENGGCSHLCLRSPNPSGFSCTCPTGINLMPDGKTCSPGM
NSFLIFARRIDVRMVSLDIPYFADVVVPINITMKNTIAIGVDPQEGKVYWSDSTLHRISR
ANLDGSQHEDIITTGLQTTDGLAVDAIGRKVYWTDTGTNRIEVGNLDGSMRKVLVWQNLD
SPRAIVLYHEMGFMYWTDWGENAKLERSGMDGSDRTVLINNNLGWPNGLTVDKASSQLLW
ADAHTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXI
LVRSNLPGLMDIQAVDRAQLLGFNKCGSRNGGCSHLCLPRPSGFSCACPTGIQLKGDGKT
CDPSPETYLLFSSRGSIRRISLDTSDHTDVHVPVPELNNVISLDYDSVDGKVYYTDVFLD
VIRRADLNGSNMETVIGRGLKTTDGLAVDWVARNLYWTDTGRNTIEASRLDGSCRKVLVN
NSLDEPRAIAVFPRKGYLFWTDWGHIAKIERANLDGSERKVLINTDLGWPNGLTLDYDTR
RIYWVDAHLDRIESADLSGKLRQVLVSHVSHPFALTQQDRWIYWTDWQTKSIQRVDKYSG
RNKETVLANVEGLMDIIVVSPQRQTGTNACGVNNGGCTHLCFARTSDFVCACPDEPDGRP
CSLEPGLVPPAPRVTSMSGRSPILPNTLPTTFRSSTTRTHTSLXXXXXXCSEKDAQLGLC
AHSNEAIPATPGEGLHVSYVIGGLLSILLILVVIAALMLYRHKKSKLTDPGMGNLTYSNP
SYRTSTQEVKIEAIPKPAMYNQLCYKKEGGPDHNYTKEKVKIVEGICLLSGDEAEWDDLK
QLRSSRGGLLRDHVCMKTDTVSIQASSGSLDDTETEQLLQEEQSECSSVHTAATPERRGS
LPDTGWRHERKLSSESQV
Download sequence
Identical sequences ENSVPAP00000011010 ENSVPAP00000011010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]