SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000011243 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000011243
Domain Number 1 Region: 51-137
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.73e-32
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000339
Further Details:      
 
Domain Number 2 Region: 248-317
Classification Level Classification E-value
Superfamily E set domains 7e-23
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000011243   Gene: ENSVPAG00000012088   Transcript: ENSVPAT00000012087
Sequence length 318
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2838:403:4924:-1 gene:ENSVPAG00000012088 transcript:ENSVPAT00000012087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGEWLDCSARRGPSCDPGPGPAPGTPAMDXXXXXXXXXXXXXXXXXXXXXXEQPKQRGMR
FRKGEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKD
CRDGFYEAELCPDRCIHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXDIEVYFTGPGKEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRR
PSDRELSEPMEFQYLPDT
Download sequence
Identical sequences ENSVPAP00000011243 ENSVPAP00000011243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]