SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000011298 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000011298
Domain Number 1 Region: 282-403
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.44e-30
Family Phosphofructokinase 0.00017
Further Details:      
 
Domain Number 2 Region: 676-813
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.31e-21
Family Phosphofructokinase 0.0021
Further Details:      
 
Domain Number 3 Region: 454-515
Classification Level Classification E-value
Superfamily Phosphofructokinase 0.00000000000628
Family Phosphofructokinase 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000011298   Gene: ENSVPAG00000012146   Transcript: ENSVPAT00000012148
Sequence length 846
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1442:175504:228834:1 gene:ENSVPAG00000012146 transcript:ENSVPAT00000012148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKKEFHLKFFICIQSCVRTPQRTAGEASASSMLMQKRPSETDALKSLDSVEDPDTVEGI
PVFKNEWIMTHEEHHAAKTLGVGKAIAVLTSGGDAQXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYLALVTSLSCGADWVFIPE
CPPDDDWEEHLCRRLSETRNRGSRLNIIIVAEGAIDKNGKPITSEEIKNLVVKRLGYDTR
VTVLGHVQRGGTPSAFDRILGSMGVEAVMALLEGTPDTPACVVXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXSFMNNWEVYKILAHVRPPLSKSGSHTVAVMNVGAPAA
GMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXANEHLVQKMKTTVKRGLVLRNEKCNGNYTTDFIFNLYSEEGKGIFDS
RKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMR
KRALIFQPVTELMEQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSEHAHLEHISRKR
SGEAAV
Download sequence
Identical sequences ENSVPAP00000011298 ENSVPAP00000011298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]