SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000011355 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000011355
Domain Number 1 Region: 8-117
Classification Level Classification E-value
Superfamily Chaperone J-domain 5.5e-29
Family Chaperone J-domain 0.0000252
Further Details:      
 
Domain Number 2 Region: 264-331
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 8.63e-17
Family HSP40/DnaJ peptide-binding domain 0.00087
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000011355
Domain Number - Region: 157-190
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.000262
Family HSP40/DnaJ peptide-binding domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000011355   Gene: ENSVPAG00000012216   Transcript: ENSVPAT00000012215
Sequence length 340
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1345:77:3459:-1 gene:ENSVPAG00000012216 transcript:ENSVPAT00000012215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLEDPTTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRK
REIFDRYGEEGLKGGGPSGGSSGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRN
GEEGMDIDDPFSGFPMGMGGFTNMNFGRSRPAQEPTRKKQDPPVTHDLWVSLEEIYSGCT
KKMKIFHKRLNPDGKSIRNEDKIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGE
GLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI
Download sequence
Identical sequences ENSVPAP00000011355 ENSVPAP00000011355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]