SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000011371 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000011371
Domain Number 1 Region: 65-177
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.37e-21
Family N-acetyl transferase, NAT 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000011371   Gene: ENSVPAG00000012232   Transcript: ENSVPAT00000012231
Sequence length 181
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_413:502766:508223:-1 gene:ENSVPAG00000012232 transcript:ENSVPAT00000012231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPEKLVLRLCADLKKGFFKVLGQLTET
GVVNPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVV
VSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRRFL
K
Download sequence
Identical sequences ENSVPAP00000011371 ENSVPAP00000011371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]