SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000011385 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000011385
Domain Number 1 Region: 102-186
Classification Level Classification E-value
Superfamily E set domains 0.0000000034
Family Filamin repeat (rod domain) 0.017
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000011385
Domain Number - Region: 356-550
Classification Level Classification E-value
Superfamily SGNH hydrolase 0.00916
Family Rhamnogalacturonan acetylesterase 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000011385   Gene: ENSVPAG00000012249   Transcript: ENSVPAT00000012249
Sequence length 559
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3075:1081468:1127511:1 gene:ENSVPAG00000012249 transcript:ENSVPAT00000012249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWINFFNLRLFCCLLAVLMVVVLVINVTQVEYLDHETASATFIDSSGHFVSSQVTGVSRN
PYCGYEHQTLSSQERLEEDSLLAAFQWQVPDVGPVPFLKSTDPSSSYFVILNSAALFKVG
SQLEVLVHVQDFQRKPKKYGGDYLQARIHSPKLQAGAVGRVVDYQNGFYKVFFTLLWPGK
VKVAISLVHPSEGIRVLQHLQEGKPDRVYFKSLFRSGRISETTECNVCLPGGLPLCNFTD
LYTGEPWFCFKPKKLPCSSRINHFKGGYLKGLLTAAETAFFQSGVNIKMPINSSGPDWVT
VIPRSIKEANNLELFQGSGTFPSGYYYKDQWRPRKFKMRQFNDPDNITECLQRKVVYLFG
DSTIRQWFEYLTTFVPDLVEFNLGSPKNVGPFLAVDQKHNILLKYRCHGPPIRFTTVFSN
DLRYVANELNGIVGGKNTVVAIAVWSHFSTFPLEVYIRRLRNIRRAVVQLLDRSPKTVVV
IRTANAQELGPEVSLFNSDWYNFQLDTVLRKMFSGVGVYLVDAWEMTLAHYLPHKLHPDE
VIVKNQLDMFLSFVCPLET
Download sequence
Identical sequences ENSVPAP00000011385 ENSVPAP00000011385 XP_006208092.1.17985 XP_015097927.1.17985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]