SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000011572 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000011572
Domain Number 1 Region: 262-356
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.27e-21
Family L-aminoacid/polyamine oxidase 0.00073
Further Details:      
 
Domain Number 2 Region: 154-281
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.38e-19
Family FAD-linked reductases, N-terminal domain 0.0013
Further Details:      
 
Domain Number 3 Region: 1-37
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000186
Family FAD-linked reductases, N-terminal domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000011572   Gene: ENSVPAG00000012446   Transcript: ENSVPAT00000012447
Sequence length 358
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_682:39386:41963:-1 gene:ENSVPAG00000012446 transcript:ENSVPAT00000012447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTILEADNRIGGRIFTYRDQKTGWIGELGAMRMPSSHXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXYLLGENLSQPAVRLLGDVMSKDGFFYLSFSEALRAHSCLSDRLRYSRIVGGW
DLLPRALLSSLSGPVLLHAPVVAIKQGMHEVSVHVASSRRARNLRSMTADVVLLTVSGPA
LQRITFTPPLTRRRQEAVRALHYVPATKVFLSFRRPFWHDEHIEGGHSNTDRPSRVIFYP
PPGEGALLLASYTWSDAAATFAGLSLADSLRLALDDVAALHGPIVYRLWDGSGAVKRW
Download sequence
Identical sequences ENSVPAP00000011572 ENSVPAP00000011572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]